Rho associated coiled-coil containing protein kinase 2
Kinase structure
Kinase:ROCK2
Family:DMPK
Group:AGC
Species:HUMAN
IUPHAR/BPS ID:1504
PDB:5U7Q
sc-PDB:
KIDFamMap:Search
Release date:2017-03-29
PubMed: 28284870
Chain:C
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 5U7Q
5U7QChain: A
5U7QChain: B
5U7QChain: D


Structural information
DFG conformation:in
αC-helix conformation:in
G-rich loop angle (distance):58.8° (18Å)
G-rich loop rotation:77.1°
Quality Score:8
Resolution:3.15 Å
Missing Residues:0
Missing Atoms:0

Pocket alignment
Uniprot sequence:KVIGRGAFGEVQLYAMKLLFFWEERDIMAFANPWVVQLFYAYMVMEYMPGGDLVNLMSNAIHSMGLIHRDVKPDNMLLLADFGTC
Sequence structure:KVIGRGAFGEVQLYAMKLLFFWEERDIMAFANPWVVQLFYAYMVMEYMPGGDLVNLMSNAIHSMGLIHRDVKPDNMLLLADFGTC