5U7Q - chain C | Rho associated coiled-coil containing protein kinase 2
Structure information
PDB: | 5U7Q |
PubMed: | 28284870 |
Release date: | 2017-03-29 |
Resolution: | 3.15 Å |
Kinase: | ROCK2 |
Family: | DMPK |
Group: | AGC |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.8Å) |
ASP rotation (xDFG.81) : | 5° |
PHE rotation (xDFG.82) : | 7° |
Activation loop position: | -4.7Å |
αC-helix position: | 16.1Å |
G-rich loop angle: | 58.8° |
G-rich loop distance: | 18Å |
G-rich loop rotation: | 77.1° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | KVIGRGAFGEVQLYAMKLLFFWEERDIMAFANPWVVQLFYAYMVMEYMPGGDLVNLMSNAIHSMGLIHRDVKPDNMLLLADFGTC |
Structure: | KVIGRGAFGEVQLYAMKLLFFWEERDIMAFANPWVVQLFYAYMVMEYMPGGDLVNLMSNAIHSMGLIHRDVKPDNMLLLADFGTC |
Modified residues
No modified residues identified.