5L2Q - chain B (model A) | Serine/threonine kinase 40
The annotation of this kinase contains errors and will be reprocessed by KLIFS.
Structure information
PDB: | 5L2Q |
PubMed: | 28089446 |
Release date: | 2017-02-01 |
Resolution: | 2.53 Å |
Kinase: | STK40 (SgK495) |
Family: | SgK495 |
Group: | CAMK |
Species: | HUMAN |
Quality Score: | 5.5 |
Missing Residues: | 0 |
Missing Atoms: | 17 |
DFG conformation: | in |
αC-helix conformation: | na |
Salt bridge KIII.17 and EαC.24: | NA |
ASP rotation (xDFG.81) : | ° |
PHE rotation (xDFG.82) : | 180° |
Activation loop position: | -3.6Å |
αC-helix position: | 0Å |
G-rich loop angle: | - |
G-rich loop distance: | - |
G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | -------------------------------------------------NLQHYVIKEKALHQKNIVHRDLKLGNMVLITNFCLG |
Structure: | ________________________________FYQLKILTLFSDKTADLNLQHYVIKEKALHQKNIVHRDLKLGNMVLITNFCLG |
Modified residues
No modified residues identified.