5L2Q - chain D (model B) | Serine/threonine kinase 40
The annotation of this kinase contains errors and will be reprocessed by KLIFS.
Structure information
| PDB: | 5L2Q |
| PubMed: | 28089446 |
| Release date: | 2017-02-01 |
| Resolution: | 2.53 Å |
| Kinase: | STK40 (SgK495) |
| Family: | SgK495 |
| Group: | CAMK |
| Species: | HUMAN |
| Quality Score: | 4 |
| Missing Residues: | 0 |
| Missing Atoms: | 68 |
| DFG conformation: | out-like |
| αC-helix conformation: | out |
| Salt bridge KIII.17 and EαC.24: | NA |
| ASP rotation (xDFG.81) : | 237° |
| PHE rotation (xDFG.82) : | 305° |
| Activation loop position: | -3.9Å |
| αC-helix position: | 27.7Å |
| G-rich loop angle: | - |
| G-rich loop distance: | - |
| G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I11
No H-bonds
Binding pocket sequence
| Uniprot | -------------------------------------------------NLQHYVIKEKALHQKNIVHRDLKLGNMVLITNFCLG |
| Structure: | ____________________KRAGPFILGPRLRQGKMLLHTAHDKTADLNLQHYVIKEKALHQKNIVHRDLKLGNMVLITNFCLG |
Modified residues
No modified residues identified.