5VCZ - chain A (model A) | Protein kinase, membrane associated tyrosine/threonine 1
Structure information
PDB: | 5VCZ |
PubMed: | 28792760 |
Release date: | 2017-08-23 |
Resolution: | 1.5 Å |
Kinase: | PKMYT1 (MYT1) |
Family: | WEE |
Group: | Other |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.8Å) |
ASP rotation (xDFG.81) : | 343° |
PHE rotation (xDFG.82) : | 358° |
Activation loop position: | -3.1Å |
αC-helix position: | 18.1Å |
G-rich loop angle: | 58° |
G-rich loop distance: | 18Å |
G-rich loop rotation: | 52.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I2
H-bond protein
I4
H-bond protein
I5
H-bond ligand
H-bond protein
Binding pocket sequence
Uniprot | SRLGHGSYGEVFKYAVKRSRKLAEVGSHEKVGPCCVRLEQAYLQTELC-GPSLQQHCEAHLHSQGLVHLDVKPANIFLLGDFGLL |
Structure: | SRLGHGSYGEVFKYAVKRSRKLAEVGSHEKVGPCCVRLEQAYLQTELC_GPSLQQHCEAHLHSQGLVHLDVKPANIFLLGDFGLL |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: XZN
Ligand Name: 4-[(3,5-DICHLORO-4-METHOXYPHENYL)AMINO]-6-METHOXY-7-[3-(4-METHYLPIPERAZIN-1-YL)PROPOXY]QUINOLINE-3-CARBONITRILE
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 S 114 | 2 R 115 | 3 L 116 | 4 G 117 | 5 H 118 | 6 G 119 | 7 S 120 | 8 Y 121 | 9 G 122 | 10 E 123 | 11 V 124 | 12 F 125 | 13 K 126 | 14 Y 136 | 15 A 137 | 16 V 138 | 17 K 139 | 18 R 140 | 19 S 141 | 20 R 153 |
■ | ■ | ■ | ■ | ■ | |||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 K 154 | 22 L 155 | 23 A 156 | 24 E 157 | 25 V 158 | 26 G 159 | 27 S 160 | 28 H 161 | 29 E 162 | 30 K 163 | 31 V 164 | 32 G 165 | 33 P 168 | 34 C 169 | 35 C 170 | 36 V 171 | 37 R 172 | 38 L 173 | 39 E 174 | 40 Q 175 |
■ | ■ | ||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 A 176 | 42 Y 184 | 43 L 185 | 44 Q 186 | 45 T 187 | 46 E 188 | 47 L 189 | 48 C 190 | 49 _ _ | 50 G 191 | 51 P 192 | 52 S 193 | 53 L 194 | 54 Q 195 | 55 Q 196 | 56 H 197 | 57 C 198 | 58 E 199 | 59 A 200 | 60 H 223 |
■ | ■ | ■ | ■▲ | ■ | ■ | ■ | |||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 224 | 62 H 225 | 63 S 226 | 64 Q 227 | 65 G 228 | 66 L 229 | 67 V 230 | 68 H 231 | 69 L 232 | 70 D 233 | 71 V 234 | 72 K 235 | 73 P 236 | 74 A 237 | 75 N 238 | 76 I 239 | 77 F 240 | 78 L 241 | 79 L 249 | 80 G 250 |
■♦♦ | |||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 251 | 82 F 252 | 83 G 253 | 84 L 254 | 85 L 255 | |||||||||||||||
■ |
Binding affinities
ChEMBL ID:CHEMBL4067978Bioaffinities: 3 records for 3 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Serine/threonine-protein kinase WEE1 | 7.4 | 7.4 | 7.4 | pKd | 1 |
Homo sapiens | Tyrosine- and threonine-specific cdc2-inhibitory kinase | 6.4 | 6.4 | 6.4 | pKd | 1 |
Homo sapiens | Wee1-like protein kinase 2 | 8.3 | 8.3 | 8.3 | pKd | 1 |