5VE6 - chain A | Tyrosine-protein kinase SgK223
This structure contains errors and will be reprocessed by KLIFS.
Structure information
| PDB: | 5VE6 |
| PubMed: | 29079850 |
| Release date: | 2017-10-18 |
| Resolution: | 2.95 Å |
| Kinase: | PRAG1 (SgK223) |
| Family: | NKF3 |
| Group: | Other |
| Species: | HUMAN |
| Quality Score: | 1.2 |
| Missing Residues: | 22 |
| Missing Atoms: | 0 |
| DFG conformation: | out |
| αC-helix conformation: | na |
| Salt bridge KIII.17 and EαC.24: | NA |
| ASP rotation (xDFG.81) : | ° |
| PHE rotation (xDFG.82) : | 180° |
| Activation loop position: | -5.8Å |
| αC-helix position: | 0Å |
| G-rich loop angle: | 55.8° |
| G-rich loop distance: | 15.8Å |
| G-rich loop rotation: | 103.1° |
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I11
No H-bonds
Binding pocket sequence
| Uniprot | KPCCDSGDAIYYCYAVKICVASVPSSMLSSPDPPAQEQDCVREVPHQT-ASDFVRDSAAHLKEHGIIHRDLCLENLLLISNFLKA |
| Structure: | SVPVHFNIQQDCGSMLSAQ______________________VITREVPHQTASDFVRDSHLKEHGIIHRDLCLENLLLPRLIISN |
Modified residues
No modified residues identified.