5W5O - chain C | Receptor interacting serine/threonine kinase 2
Structure information
PDB: | 5W5O |
PubMed: | 29057049 |
Release date: | 2017-10-25 |
Resolution: | 2.89 Å |
Kinase: | RIPK2 |
Family: | RIPK |
Group: | TKL |
Species: | HUMAN |
Quality Score: | 7.6 |
Missing Residues: | 1 |
Missing Atoms: | 20 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No |
ASP rotation (xDFG.81) : | 350° |
PHE rotation (xDFG.82) : | 9° |
Activation loop position: | -3.5Å |
αC-helix position: | 17.6Å |
G-rich loop angle: | 46.5° |
G-rich loop distance: | 14.2Å |
G-rich loop rotation: | 44.9° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | RYLSRGASGTVSSVAVKHLDVLREAEILHKARSYILPILGIGIVTEYMPNGSLNELLHRHNMTPPLLHHDLKTQNILLIADFGLS |
Structure: | RYLSRGASGTVSSVAVKH_DVLREAEILHKARSYILPILGIGIVTEYMPNGSLNELLHRHNMTPPLLHHDLKTQNILLIADFGLS |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: 9XA
Ligand Name: 4-{6-(tert-butylsulfonyl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]imidazo[1,2-a]pyridin-3-yl}-6-chloropyridin-2-amine
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 R 22 | 2 Y 23 | 3 L 24 | 4 S 25 | 5 R 26 | 6 G 27 | 7 A 28 | 8 S 29 | 9 G 30 | 10 T 31 | 11 V 32 | 12 S 33 | 13 S 34 | 14 V 44 | 15 A 45 | 16 V 46 | 17 K 47 | 18 H 48 | 19 _ _ | 20 D 62 |
■ | ■▲ | ■ | ■ | ■ | |||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 V 63 | 22 L 64 | 23 R 65 | 24 E 66 | 25 A 67 | 26 E 68 | 27 I 69 | 28 L 70 | 29 H 71 | 30 K 72 | 31 A 73 | 32 R 74 | 33 S 76 | 34 Y 77 | 35 I 78 | 36 L 79 | 37 P 80 | 38 I 81 | 39 L 82 | 40 G 83 |
■ | |||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 I 84 | 42 G 92 | 43 I 93 | 44 V 94 | 45 T 95 | 46 E 96 | 47 Y 97 | 48 M 98 | 49 P 99 | 50 N 100 | 51 G 101 | 52 S 102 | 53 L 103 | 54 N 104 | 55 E 105 | 56 L 106 | 57 L 107 | 58 H 108 | 59 R 109 | 60 H 136 |
■ | ■▲ | ■ | ■ | ■ | |||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 N 137 | 62 M 138 | 63 T 139 | 64 P 140 | 65 P 141 | 66 L 142 | 67 L 143 | 68 H 144 | 69 H 145 | 70 D 146 | 71 L 147 | 72 K 148 | 73 T 149 | 74 Q 150 | 75 N 151 | 76 I 152 | 77 L 153 | 78 L 154 | 79 I 162 | 80 A 163 |
■ | ■ | ||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 164 | 82 F 165 | 83 G 166 | 84 L 167 | 85 S 168 | |||||||||||||||
▲ |
Binding affinities
ChEMBL ID:CHEMBL4162788Bioaffinities: 1 record for 1 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Serine/threonine-protein kinase RIPK2 | 8.1 | 8.1 | 8.1 | pIC50 | 1 |