5YKS - chain B | SNF related kinase
Structure information
| PDB: | 5YKS |
| PubMed: | 29061304 |
| Release date: | 2017-11-08 |
| Resolution: | 2.9 Å |
| Kinase: | SNRK |
| Family: | CAMKL |
| Group: | CAMK |
| Species: | HUMAN |
| Quality Score: | 8.5 |
| Missing Residues: | 0 |
| Missing Atoms: | 7 |
| DFG conformation: | in |
| αC-helix conformation: | out |
| Salt bridge KIII.17 and EαC.24: | No (10.3Å) |
| ASP rotation (xDFG.81) : | 331° |
| PHE rotation (xDFG.82) : | 5° |
| Activation loop position: | -3.8Å |
| αC-helix position: | 20.3Å |
| G-rich loop angle: | 84° |
| G-rich loop distance: | 20Å |
| G-rich loop rotation: | 100.3° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | KTLGRGHFAVVKLVAVKVIHLFQEVRCMKLVQPNIVRLYEVYLILELGDGGDMFDYIMKYCHKLHVVHRDLKPENVVFLTDFGFS |
| Structure: | QGPHMGHFAVVKLVAVKVIHLFQEVRCMKLVQPNIVRLYEVYLILELGDGGDMFDYIMKYCHKLHVVHRDLKPENVVFLTDFGFS |
Modified residues
No modified residues identified.