1YOM - chain A | SRC proto-oncogene, non-receptor tyrosine kinase
Structure information
PDB: | 1YOM |
PubMed: | 16168436 |
Release date: | 2006-01-27 |
Resolution: | 2.9 Å |
Kinase: | SRC |
Family: | Src |
Group: | TK |
Species: | HUMAN |
Quality Score: | 5.7 |
Missing Residues: | 3 |
Missing Atoms: | 15 |
DFG conformation: | out-like |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No |
ASP rotation (xDFG.81) : | 49° |
PHE rotation (xDFG.82) : | 18° |
Activation loop position: | 5.7Å |
αC-helix position: | 17.7Å |
G-rich loop angle: | 61.1° |
G-rich loop distance: | 19.1Å |
G-rich loop rotation: | 47.7° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | VKLGQGCFGEVWMVAIKTLAFLQEAQVMKKLREKLVQLYAVYIVTEYMSKGSLLDFLKGYVERMNYVHRDLRAANILVVADFGLA |
Structure: | VKLGQGCFGEVWMVAIKTLAFLQEAQVMKKLREKLVQLYAVYIVTEYMNKGSLLDFLKGYVERMNYVHRDLRAANILVVADF___ |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: P01
Ligand Name: 2-({6-[(3-CHLOROPHENYL)AMINO]-9-ISOPROPYL-9H-PURIN-2-YL}AMINO)-3-METHYLBUTAN-1-OL
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 V 273 | 2 K 274 | 3 L 275 | 4 G 276 | 5 Q 277 | 6 G 278 | 7 C 279 | 8 F 280 | 9 G 281 | 10 E 282 | 11 V 283 | 12 W 284 | 13 M 285 | 14 V 294 | 15 A 295 | 16 I 296 | 17 K 297 | 18 T 298 | 19 L 299 | 20 A 308 |
■ | ■ | ■ | ■ | ■ | |||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 F 309 | 22 L 310 | 23 Q 311 | 24 E 312 | 25 A 313 | 26 Q 314 | 27 V 315 | 28 M 316 | 29 K 317 | 30 K 318 | 31 L 319 | 32 R 320 | 33 E 322 | 34 K 323 | 35 L 324 | 36 V 325 | 37 Q 326 | 38 L 327 | 39 Y 328 | 40 A 329 |
■ | |||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 V 330 | 42 Y 337 | 43 I 338 | 44 V 339 | 45 T 340 | 46 E 341 | 47 Y 342 | 48 M 343 | 49 N 344 | 50 K 345 | 51 G 346 | 52 S 347 | 53 L 348 | 54 L 349 | 55 D 350 | 56 F 351 | 57 L 352 | 58 K 353 | 59 G 354 | 60 Y 378 |
■ | ■ | ■♦ | ■▲▲ | ■ | ■ | ■ | |||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 V 379 | 62 E 380 | 63 R 381 | 64 M 382 | 65 N 383 | 66 Y 384 | 67 V 385 | 68 H 386 | 69 R 387 | 70 D 388 | 71 L 389 | 72 R 390 | 73 A 391 | 74 A 392 | 75 N 393 | 76 I 394 | 77 L 395 | 78 V 396 | 79 V 404 | 80 A 405 |
■ | |||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 406 | 82 F 426 | 83 _ _ | 84 _ _ | 85 _ _ | |||||||||||||||
Binding affinities
ChEMBL ID:CHEMBL23327Bioaffinities: 18 records for 10 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Patiria pectinifera | Cdc2 | 6.3 | 6.3 | 7.4 | pIC50 | 2 |
Saccharomyces cerevisiae S288c | Cell division control protein 28 | 7.1 | 7.1 | 7.1 | pIC50 | 1 |
Homo sapiens | Cyclin-dependent kinase 1 | 4.5 | 4.5 | 7.3 | pIC50 | 3 |
Homo sapiens | Cyclin-dependent kinase 2 | 7.2 | 7.2 | 8.4 | pIC50 | 5 |
Homo sapiens | Dual-specificity tyrosine-phosphorylation regulated kinase 1A | 6.5 | 6.5 | 6.5 | pIC50 | 1 |
Homo sapiens | Insulin receptor | 5.3 | 5.3 | 5.3 | pIC50 | 1 |
Homo sapiens | MAP kinase ERK1 | 5.1 | 5.1 | 5.1 | pIC50 | 2 |
Plasmodium falciparum | Protein kinase Pfmrk | 4.6 | 4.6 | 4.6 | pIC50 | 1 |
Homo sapiens | Serine/threonine-protein kinase PAK 4 | 6.9 | 6.9 | 6.9 | pIC50 | 1 |
Homo sapiens | Tyrosine-protein kinase SRC | 6.6 | 6.6 | 6.6 | pIC50 | 1 |