1YOJ - chain B | SRC proto-oncogene, non-receptor tyrosine kinase
Structure information
| PDB: | 1YOJ |
| PubMed: | 16168436 |
| Release date: | 2006-01-27 |
| Resolution: | 1.95 Å |
| Kinase: | SRC |
| Family: | Src |
| Group: | TK |
| Species: | HUMAN |
| Quality Score: | 3.6 |
| Missing Residues: | 20 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | na |
| Salt bridge KIII.17 and EαC.24: | NA |
| ASP rotation (xDFG.81) : | 1° |
| PHE rotation (xDFG.82) : | 12° |
| Activation loop position: | -4.1Å |
| αC-helix position: | 0Å |
| G-rich loop angle: | - |
| G-rich loop distance: | - |
| G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | VKLGQGCFGEVWMVAIKTLAFLQEAQVMKKLREKLVQLYAVYIVTEYMSKGSLLDFLKGYVERMNYVHRDLRAANILVVADFGLA |
| Structure: | VKL______EV__VAIKTL_________KKLREKLVQLYAVYIVTEYMNKGSLLDFLKGYVERMNYVHRDLRAANILVVADF___ |
Modified residues
No modified residues identified.