6CMM - chain A (model B) | Vaccinia related kinase 1
Structure information
PDB: | 6CMM |
PubMed: | - |
Release date: | 2018-03-21 |
Resolution: | 2.1 Å |
Kinase: | VRK1 |
Family: | VRK |
Group: | CK1 |
Species: | HUMAN |
Quality Score: | 7.8 |
Missing Residues: | 2 |
Missing Atoms: | 14 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.7Å) |
ASP rotation (xDFG.81) : | 347° |
PHE rotation (xDFG.82) : | 21° |
Activation loop position: | -3.2Å |
αC-helix position: | 17.7Å |
G-rich loop angle: | - |
G-rich loop distance: | - |
G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | LPIGQGGFGCIYLCVVKVEPLFTELKFYQRAALGVPKYWGSFMIMDRFG-SDLQKIYEAYIHEHEYVHGDIKASNLLLLVDYGLA |
Structure: | LPIGQ__FGCIYLCVVKVEPLFTELKFYQRAALGVPKYWGSFMIMDRFG_SDLQKIYEAYIHEHEYVHGDIKASNLLLLVDYGLA |
Modified residues
No modified residues identified.