2HZ4 - chain A | ABL proto-oncogene 1, non-receptor tyrosine kinase
Structure information
PDB: | 2HZ4 |
PubMed: | 17164530 |
Release date: | 2007-01-16 |
Resolution: | 2.8 Å |
Kinase: | ABL1 |
Family: | Abl |
Group: | TK |
Species: | HUMAN |
Quality Score: | 6 |
Missing Residues: | 5 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (4.2Å) |
ASP rotation (xDFG.81) : | 343° |
PHE rotation (xDFG.82) : | 4° |
Activation loop position: | -3.1Å |
αC-helix position: | 18Å |
G-rich loop angle: | - |
G-rich loop distance: | - |
G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS |
Structure: | HKLG_____EVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS |
Modified residues
No modified residues identified.
Binding affinities
Ligand not found in ChEMBL.