2HIW - chain A | ABL proto-oncogene 1, non-receptor tyrosine kinase
Structure information
PDB: | 2HIW |
PubMed: | 16873026 |
Release date: | 2006-08-22 |
Resolution: | 2.2 Å |
Kinase: | ABL1 |
Family: | Abl |
Group: | TK |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | out |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (3.7Å) |
ASP rotation (xDFG.81) : | 194° |
PHE rotation (xDFG.82) : | 180° |
Activation loop position: | 2.5Å |
αC-helix position: | 18.4Å |
G-rich loop angle: | 54.9° |
G-rich loop distance: | 16.6Å |
G-rich loop rotation: | 41.8° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I1
H-bond protein
Binding pocket sequence
Uniprot | HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS |
Structure: | HKLGGGQYGEVYEVAVKTLEFLKEAAVMKEIKPNLVQLLGVYIITEFMTYGNLLDYLREYLEKKNFIHRDLAARNCLVVADFGLS |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: 7MP
Ligand Name: 7-AMINO-1-METHYL-3-(2-METHYL-5-{[3-(TRIFLUOROMETHYL)BENZOYL]AMINO}PHENYL)-2-OXO-2,3-DIHYDROPYRIMIDO[4,5-D]PYRIMIDIN-1-IUM
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 H 264 | 2 K 265 | 3 L 266 | 4 G 267 | 5 G 268 | 6 G 269 | 7 Q 270 | 8 Y 271 | 9 G 272 | 10 E 273 | 11 V 274 | 12 Y 275 | 13 E 276 | 14 V 286 | 15 A 287 | 16 V 288 | 17 K 289 | 18 T 290 | 19 L 291 | 20 E 300 |
■ | ■ | ■ | ■ | ■ | ■ | ||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 F 301 | 22 L 302 | 23 K 303 | 24 E 304 | 25 A 305 | 26 A 306 | 27 V 307 | 28 M 308 | 29 K 309 | 30 E 310 | 31 I 311 | 32 K 312 | 33 P 314 | 34 N 315 | 35 L 316 | 36 V 317 | 37 Q 318 | 38 L 319 | 39 L 320 | 40 G 321 |
■ | ■ | ■ | ■ | ■ | ■ | ||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 V 322 | 42 Y 330 | 43 I 331 | 44 I 332 | 45 T 333 | 46 E 334 | 47 F 335 | 48 M 336 | 49 T 337 | 50 Y 338 | 51 G 339 | 52 N 340 | 53 L 341 | 54 L 342 | 55 D 343 | 56 Y 344 | 57 L 345 | 58 R 346 | 59 E 347 | 60 Y 371 |
■ | ■ | ■ | ■ | ■▲▲ | |||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 372 | 62 E 373 | 63 K 374 | 64 K 375 | 65 N 376 | 66 F 377 | 67 I 378 | 68 H 379 | 69 R 380 | 70 D 381 | 71 L 382 | 72 A 383 | 73 A 384 | 74 R 385 | 75 N 386 | 76 C 387 | 77 L 388 | 78 V 389 | 79 V 397 | 80 A 398 |
■ | ■ | ■ | ■ | ■ | |||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 399 | 82 F 400 | 83 G 401 | 84 L 402 | 85 S 403 | |||||||||||||||
■▲ | ■♦ |
Binding affinities
ChEMBL ID:CHEMBL459850Bioaffinities: 21 records for 20 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Ephrin type-A receptor 3 | 8.7 | 8.7 | 8.7 | pEC50 | 1 |
Homo sapiens | Ephrin type-B receptor 4 | 8.4 | 8.4 | 8.4 | pEC50 | 1 |
Homo sapiens | Fibroblast growth factor receptor 1 | 7.1 | 7.1 | 7.1 | pEC50 | 1 |
Homo sapiens | Fibroblast growth factor receptor 3 | 7.9 | 7.9 | 7.9 | pIC50 | 1 |
Homo sapiens | Mitogen-activated protein kinase kinase kinase kinase 2 | 7.6 | 7.6 | 7.6 | pIC50 | 1 |
Homo sapiens | NT-3 growth factor receptor | 7.5 | 7.5 | 7.5 | pEC50 | 1 |
Homo sapiens | Platelet-derived growth factor receptor alpha | 8.4 | 8.4 | 8.4 | pEC50 | 1 |
Homo sapiens | Platelet-derived growth factor receptor beta | 8.2 | 8.2 | 8.2 | pEC50 | 1 |
Homo sapiens | Stem cell growth factor receptor | 8.4 | 8.4 | 8.4 | pEC50 | 1 |
Homo sapiens | Tyrosine kinase non-receptor protein 2 | 7.8 | 7.8 | 7.8 | pIC50 | 1 |
Homo sapiens | Tyrosine-protein kinase ABL | 5.8 | 5.8 | 5.8 | pIC50 | 1 |
Mus musculus | Tyrosine-protein kinase ABL | 6.6 | 6.6 | 6.6 | pIC50 | 1 |
Homo sapiens | Tyrosine-protein kinase BMX | 7.5 | 7.5 | 7.5 | pEC50 | 1 |
Homo sapiens | Tyrosine-protein kinase BMX | 8.9 | 8.9 | 8.9 | pIC50 | 1 |
Homo sapiens | Tyrosine-protein kinase FES | 9 | 9 | 9 | pIC50 | 1 |
Homo sapiens | Tyrosine-protein kinase LCK | 8.3 | 8.3 | 8.3 | pEC50 | 1 |
Homo sapiens | Tyrosine-protein kinase receptor RET | 7.1 | 7.1 | 7.1 | pEC50 | 1 |
Homo sapiens | Tyrosine-protein kinase SRC | 7.9 | 7.9 | 7.9 | pEC50 | 1 |
Homo sapiens | Tyrosine-protein kinase TIE-2 | 6.7 | 6.7 | 6.7 | pEC50 | 1 |
Homo sapiens | Vascular endothelial growth factor receptor 1 | 6.6 | 6.6 | 6.6 | pEC50 | 1 |
Homo sapiens | Vascular endothelial growth factor receptor 2 | 7.7 | 7.7 | 7.7 | pEC50 | 1 |