6NPZ - chain B (model A) | V-akt murine thymoma viral oncogene homolog 1
Structure information
| PDB: | 6NPZ |
| PubMed: | 30078705 |
| Release date: | 2019-01-30 |
| Resolution: | 2.12 Å |
| Kinase: | AKT1 |
| Family: | Akt |
| Group: | AGC |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (3.1Å) |
| ASP rotation (xDFG.81) : | 331° |
| PHE rotation (xDFG.82) : | 2° |
| Activation loop position: | -4Å |
| αC-helix position: | 17.6Å |
| G-rich loop angle: | 60.3° |
| G-rich loop distance: | 17.9Å |
| G-rich loop rotation: | 66.1° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I1
H-bond protein
I5
H-bond protein
Binding pocket sequence
| Uniprot | KLLGKGTFGKVILYAMKILHTLTENRVLQNSRPFLTALKYSCFVMEYANGGELFFHLSRLHSEKNVVYRDLKLENLMLITDFGLC |
| Structure: | KLLGKGTFGKVILYAMKILHTLTENRVLQNSRPFLTALKYSCFVMEYANGGELFFHLSRLHSEKNVVYRDLKLENLMLITDFGLC |
Modified residues
Residue 308 (not in pocket)
Phosphorylated threonine
Residue 473 (not in pocket)
Phosphorylated serine
Residue 477 (not in pocket)
Phosphorylated serine