6FAD - chain B | SRSF protein kinase 1
Structure information
| PDB: | 6FAD |
| PubMed: | 31641093 |
| Release date: | 2019-09-25 |
| Resolution: | 2.8 Å |
| Kinase: | SRPK1 |
| Family: | SRPK |
| Group: | CMGC |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | No (4.6Å) |
| ASP rotation (xDFG.81) : | 351° |
| PHE rotation (xDFG.82) : | 3° |
| Activation loop position: | -3.6Å |
| αC-helix position: | 18.8Å |
| G-rich loop angle: | 62.2° |
| G-rich loop distance: | 19.1Å |
| G-rich loop rotation: | 43.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I8
H-bond protein
Binding pocket sequence
| Uniprot | RKLGWGHFSTVWLVAMKVVTALDEIRLLKSVREMVVQLLDDCMVFEVLG-HHLLKWIIKLHTKCRIIHTDIKPENILLIADLGNA |
| Structure: | RKLGWGHFSTVWLVAMKVVTALDEIRLLKSVREMVVQLLDDCMVFEVLG_HHLLKWIIKLHTKCRIIHTDIKPENILLIADLGNA |
Modified residues
No modified residues identified.