1MRY - chain A | V-akt murine thymoma viral oncogene homolog 2
Structure information
| PDB: | 1MRY |
| PubMed: | 12517337 |
| Release date: | 2003-09-23 |
| Resolution: | 2.8 Å |
| Kinase: | AKT2 |
| Family: | Akt |
| Group: | AGC |
| Species: | HUMAN |
| Quality Score: | 3.6 |
| Missing Residues: | 6 |
| Missing Atoms: | 43 |
| DFG conformation: | out |
| αC-helix conformation: | na |
| Salt bridge KIII.17 and EαC.24: | NA |
| ASP rotation (xDFG.81) : | 174° |
| PHE rotation (xDFG.82) : | 228° |
| Activation loop position: | 2.4Å |
| αC-helix position: | 0Å |
| G-rich loop angle: | 65° |
| G-rich loop distance: | 19.4Å |
| G-rich loop rotation: | 21.9° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | KLLGKGTFGKVILYAMKILHTVTESRVLQNTRPFLTALKYACFVMEYANGGELFFHLSRYLHSRDVVYRDIKLENLMLITDFGLC |
| Structure: | KLLGKGTFGKVILYAMKIL______RVLQNTRPFLTALKYACFVMEYANGGELFFHLSRYLHSRDVVYRDIKLENLMLITDFGLC |
Modified residues
No modified residues identified.