1MRV - chain A | V-akt murine thymoma viral oncogene homolog 2
Structure information
PDB: | 1MRV |
PubMed: | 12517337 |
Release date: | 2003-09-23 |
Resolution: | 2.8 Å |
Kinase: | AKT2 |
Family: | Akt |
Group: | AGC |
Species: | HUMAN |
Quality Score: | 4 |
Missing Residues: | 10 |
Missing Atoms: | 26 |
DFG conformation: | out |
αC-helix conformation: | na |
Salt bridge KIII.17 and EαC.24: | NA |
ASP rotation (xDFG.81) : | 183° |
PHE rotation (xDFG.82) : | 230° |
Activation loop position: | 1.6Å |
αC-helix position: | 0Å |
G-rich loop angle: | 61.5° |
G-rich loop distance: | 18.3Å |
G-rich loop rotation: | 60.9° |
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I5
H-bond protein
Binding pocket sequence
Uniprot | KLLGKGTFGKVILYAMKILHTVTESRVLQNTRPFLTALKYACFVMEYANGGELFFHLSRYLHSRDVVYRDIKLENLMLITDFGLC |
Structure: | KLLGKGTFGKVILYAMKIL_______VLQNTRPFLTALKYACFVMEYANGGELFFHLSRYLHSRDVVYRDIKLENLMLITDF___ |
Modified residues
No modified residues identified.