3O96 - chain A | V-akt murine thymoma viral oncogene homolog 1
Structure information
| PDB: | 3O96 |
| PubMed: | 20886116 |
| Release date: | 2010-10-13 |
| Resolution: | 2.7 Å |
| Kinase: | AKT1 |
| Family: | Akt |
| Group: | AGC |
| Species: | HUMAN |
| Quality Score: | 5.2 |
| Missing Residues: | 5 |
| Missing Atoms: | 0 |
| DFG conformation: | out |
| αC-helix conformation: | na |
| Salt bridge KIII.17 and EαC.24: | NA |
| ASP rotation (xDFG.81) : | 169° |
| PHE rotation (xDFG.82) : | 225° |
| Activation loop position: | 1.4Å |
| αC-helix position: | 0Å |
| G-rich loop angle: | 62.6° |
| G-rich loop distance: | 19.1Å |
| G-rich loop rotation: | 53.2° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | KLLGKGTFGKVILYAMKILHTLTENRVLQNSRPFLTALKYSCFVMEYANGGELFFHLSRLHSEKNVVYRDLKLENLMLITDFGLC |
| Structure: | KLLGKGTFGKVILYAMKIL_____NRVLQNSRPFLTALKYSCFVMEYANGGELFFHLSRLHSEKNVVYRDLKLENLMLITDFGLC |
Modified residues
No modified residues identified.
Allosteric ligand
Ligand HET-code: IQO
Ligand Name: 1-(1-(4-(7-phenyl-1H-imidazo[4,5-g]quinoxalin-6-yl)benzyl)piperidin-4-yl)-1H-benzo[d]imidazol-2(3H)-one
Binding affinities
Ligand not found in ChEMBL.