4HZS - chain D | Tyrosine kinase, non-receptor, 2
Structure information
PDB: | 4HZS |
PubMed: | 23342057 |
Release date: | 2013-02-06 |
Resolution: | 3.23 Å |
Kinase: | TNK2 (ACK) |
Family: | Ack |
Group: | TK |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (13.6Å) |
ASP rotation (xDFG.81) : | 315° |
PHE rotation (xDFG.82) : | 318° |
Activation loop position: | -5Å |
αC-helix position: | 21.6Å |
G-rich loop angle: | 55.8° |
G-rich loop distance: | 15.8Å |
G-rich loop rotation: | 52.3° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | EKLGDGSFGVVRRVAVKCLDFIREVNAMHSLDRNLIRLYGVKMVTELAPLGSLLDRLRKYLESKRFIHRDLAARNLLLIGDFGLM |
Structure: | EKLGDGSFGVVRRVAVKCLDFIREVNAMHSLDRNLIRLYGVKMVTELAPLGSLLDRLRKYLESKRFIHRDLAARNLLLIGDFGLM |
Modified residues
No modified residues identified.