2ZMC - chain A | TTK protein kinase
Structure information
PDB: | 2ZMC |
PubMed: | 18480048 |
Release date: | 2008-05-13 |
Resolution: | 3.14 Å |
Kinase: | TTK |
Family: | TTK |
Group: | Other |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No (5.8Å) |
ASP rotation (xDFG.81) : | 352° |
PHE rotation (xDFG.82) : | 345° |
Activation loop position: | -6.4Å |
αC-helix position: | 17.5Å |
G-rich loop angle: | 59.8° |
G-rich loop distance: | 18.2Å |
G-rich loop rotation: | 57° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | KQIGSGGSSKVFQYAIKYVSYRNEIAYLNKLQDKIIRLYDYYMVMECGN-IDLNSWLKKTIHQHGIVHSDLKPANFLILIDFGIA |
Structure: | KQIGSGGSSKVFQYAIKYVSYRNEIAYLNKLQDKIIRLYDYYMVMECGN_IDLNSWLKKTIHQHGIVHSDLKPANFLILIDFGIA |
Modified residues
No modified residues identified.