5CEM - chain A (model A) | Tribbles pseudokinase 1
Structure information
PDB: | 5CEM |
PubMed: | 26455797 |
Release date: | 2015-11-11 |
Resolution: | 2.1 Å |
Kinase: | TRIB1 (Trb1) |
Family: | Trbl |
Group: | CAMK |
Species: | HUMAN |
Quality Score: | 6.4 |
Missing Residues: | 1 |
Missing Atoms: | 0 |
DFG conformation: | out-like |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No |
ASP rotation (xDFG.81) : | 203° |
PHE rotation (xDFG.82) : | 246° |
Activation loop position: | -2.4Å |
αC-helix position: | 16.7Å |
G-rich loop angle: | 79.1° |
G-rich loop distance: | 22.6Å |
G-rich loop rotation: | 32° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I5
H-bond protein
Binding pocket sequence
Uniprot | LLLPLAEREHVSRLRCKVFYQDKIRPYIQLPSSNITGIVEVYVFFEKDF-GDMHSYVRSHCHQSAIVLGDLKLRKFVFLRLESLE |
Structure: | LLLPLAEREHVSRLRCKVFYQDKIRPYIQLP_SNITGIVEVYVFFEKDF_GDMHSYVRSHCHQSAIVLGDLKLRKFVFLRLESLE |
Modified residues
No modified residues identified.