4BTJ - chain B | Tau tubulin kinase 1
Structure information
PDB: | 4BTJ |
PubMed: | 24039150 |
Release date: | 2013-09-25 |
Resolution: | 2.16 Å |
Kinase: | TTBK1 |
Family: | TTBK |
Group: | CK1 |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.8Å) |
ASP rotation (xDFG.81) : | 340° |
PHE rotation (xDFG.82) : | 358° |
Activation loop position: | -3.8Å |
αC-helix position: | 17Å |
G-rich loop angle: | 52.8° |
G-rich loop distance: | 16.6Å |
G-rich loop rotation: | 38.9° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I1
H-bond protein
I5
H-bond protein
I11
H-bond ligand
Binding pocket sequence
Uniprot | KKIGGGGFGEIYEVALKVEVLKMEVAVLKKLQDHVCRFIGCYVVMQLQG-RNLADLRRSAIHSVGFLHRDIKPSNFAMMLDFGLA |
Structure: | KKIGGGGFGEIYEVALKVEVLKMEVAVLKKLQDHVCRFIGCYVVMQLQG_RNLADLRRSAIHSVGFLHRDIKPSNFAMMLDFGLA |
Modified residues
No modified residues identified.
Orthosteric ligand
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 K 62 | 2 K 63 | 3 I 64 | 4 G 65 | 5 G 66 | 6 G 67 | 7 G 68 | 8 F 69 | 9 G 70 | 10 E 71 | 11 I 72 | 12 Y 73 | 13 E 74 | 14 V 84 | 15 A 85 | 16 L 86 | 17 K 87 | 18 V 88 | 19 E 89 | 20 V 97 |
■ | ■ | ▲ | ■ | ■ | ▲● | ||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 L 98 | 22 K 99 | 23 M 100 | 24 E 101 | 25 V 102 | 26 A 103 | 27 V 104 | 28 L 105 | 29 K 106 | 30 K 107 | 31 L 108 | 32 Q 109 | 33 D 112 | 34 H 113 | 35 V 114 | 36 C 115 | 37 R 116 | 38 F 117 | 39 I 118 | 40 G 119 |
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 C 120 | 42 Y 128 | 43 V 129 | 44 V 130 | 45 M 131 | 46 Q 132 | 47 L 133 | 48 Q 134 | 49 G 135 | 50 _ _ | 51 R 136 | 52 N 137 | 53 L 138 | 54 A 139 | 55 D 140 | 56 L 141 | 57 R 142 | 58 R 143 | 59 S 144 | 60 A 168 |
▲ | ■ | ■▲ | ■▲ | ||||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 I 169 | 62 H 170 | 63 S 171 | 64 V 172 | 65 G 173 | 66 F 174 | 67 L 175 | 68 H 176 | 69 R 177 | 70 D 178 | 71 I 179 | 72 K 180 | 73 P 181 | 74 S 182 | 75 N 183 | 76 F 184 | 77 A 185 | 78 M 186 | 79 M 198 | 80 L 199 |
■▲ | ■ | ||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 200 | 82 F 201 | 83 G 202 | 84 L 203 | 85 A 204 | |||||||||||||||
Binding affinities
ChEMBL ID:CHEMBL14249Bioaffinities: 8 records for 3 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | MAP kinase-activated protein kinase 2 | 5.2 | 4.9 | 5.6 | pIC50 | 3 |
Homo sapiens | Mitogen-activated protein kinase kinase kinase 7 | 5.6 | 5.6 | 5.6 | pKd | 1 |
Homo sapiens | Tyrosine-protein kinase JAK2 | 5.9 | 5.9 | 5.9 | pKd | 4 |