5O23 - chain A (model B) | WNK lysine deficient protein kinase 3
Structure information
PDB: | 5O23 |
PubMed: | - |
Release date: | 2017-06-28 |
Resolution: | 2.25 Å |
Kinase: | WNK3 (Wnk3) |
Family: | WNK |
Group: | Other |
Species: | HUMAN |
Quality Score: | 9.6 |
Missing Residues: | 0 |
Missing Atoms: | 4 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No |
ASP rotation (xDFG.81) : | 50° |
PHE rotation (xDFG.82) : | 23° |
Activation loop position: | -3.3Å |
αC-helix position: | 22.5Å |
G-rich loop angle: | 64.3° |
G-rich loop distance: | 17.7Å |
G-rich loop rotation: | 17.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I6
H-bond protein
Binding pocket sequence
Uniprot | IELGRGAFKTVYKVAWCELRFKEEAEMLKGLQPNIVRFYDSVLVTELMTSGTLKTYLKRHTRTPPIIHRDLKCDNIFIIGDLGLA |
Structure: | IELGRGAFKTVYKVAWCELRFKEEAEMLKGLQPNIVRFYDSVLVTELMTSGTLKTYLKRHTRTPPIIHRDLKCDNIFIIGDLGLA |
Modified residues
Residue 304 (not in pocket)
Phosphorylated serine