4FZA - chain B | Serine/threonine protein kinase 26
Structure information
| PDB: | 4FZA |
| PubMed: | 23434407 |
| Release date: | 2013-03-06 |
| Resolution: | 3.15 Å |
| Kinase: | STK26 (MST4) |
| Family: | STE20 |
| Group: | STE |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 0 |
| DFG conformation: | out-like |
| αC-helix conformation: | out |
| Salt bridge KIII.17 and EαC.24: | Yes (4.2Å) |
| ASP rotation (xDFG.81) : | 112° |
| PHE rotation (xDFG.82) : | 108° |
| Activation loop position: | -0.7Å |
| αC-helix position: | 20.7Å |
| G-rich loop angle: | 55.6° |
| G-rich loop distance: | 16.3Å |
| G-rich loop rotation: | 64.2° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | ERIGKGSFGEVFKVAIKIIDIQQEITVLSQCDSYVTKYYGSWIIMEYLGGGSALDLLRAYLHSEKKIHRDIKAANVLLLADFGVA |
| Structure: | ERIGKGSFGEVFKVAIKIIDIQQEITVLSQCDSYVTKYYGSWIIMEYLGGGSALDLLRAYLHSEKKIHRDIKAANVLLLAAFGVA |
Modified residues
No modified residues identified.