4FZD - chain B | Serine/threonine protein kinase 26
Structure information
| PDB: | 4FZD |
| PubMed: | 23434407 |
| Release date: | 2013-03-06 |
| Resolution: | 3.25 Å |
| Kinase: | STK26 (MST4) |
| Family: | STE20 |
| Group: | STE |
| Species: | HUMAN |
| Quality Score: | 8.7 |
| Missing Residues: | 0 |
| Missing Atoms: | 13 |
| DFG conformation: | out-like |
| αC-helix conformation: | out |
| Salt bridge KIII.17 and EαC.24: | Yes (4.1Å) |
| ASP rotation (xDFG.81) : | 114° |
| PHE rotation (xDFG.82) : | 208° |
| Activation loop position: | -0.9Å |
| αC-helix position: | 21Å |
| G-rich loop angle: | 63.3° |
| G-rich loop distance: | 18.5Å |
| G-rich loop rotation: | 43.1° |
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I6
No H-bonds
Binding pocket sequence
| Uniprot | ERIGKGSFGEVFKVAIKIIDIQQEITVLSQCDSYVTKYYGSWIIMEYLGGGSALDLLRAYLHSEKKIHRDIKAANVLLLADFGVA |
| Structure: | ERIGKGSFGEVFKVAIKIIDIQQEITVLSQCDSYVTKYYGSWIIMEYLGGGSALDLLRAYLHSEKKIHRDIKAANVLLLAAFGVA |
Modified residues
No modified residues identified.