3COM - chain A | Serine/threonine kinase 4
Structure information
| PDB: | 3COM |
| PubMed: | - |
| Release date: | 2008-04-15 |
| Resolution: | 2.2 Å |
| Kinase: | STK4 (MST1) |
| Family: | STE20 |
| Group: | STE |
| Species: | HUMAN |
| Quality Score: | 7.2 |
| Missing Residues: | 4 |
| Missing Atoms: | 12 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (3.8Å) |
| ASP rotation (xDFG.81) : | 0° |
| PHE rotation (xDFG.82) : | 14° |
| Activation loop position: | -3.4Å |
| αC-helix position: | 16.4Å |
| G-rich loop angle: | - |
| G-rich loop distance: | - |
| G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I8
H-bond protein
Binding pocket sequence
| Uniprot | EKLGEGSYGSVYKVAIKQVEIIKEISIMQQCDPHVVKYYGSWIVMEYCGAGSVSDIIRLYLHFMRKIHRDIKAGNILLLADFGVA |
| Structure: | EKLG____GSVYKVAIKQVEIIKEISIMQQCDPHVVKYYGSWIVMEYCGAGSVSDIIRLYLHFMRKIHRDIKAGNILLLADFGVA |
Modified residues
Residue 177 (not in pocket)
Phosphorylated threonine
Residue 183 (not in pocket)
Phosphorylated threonine