Receptor tyrosine kinase-like orphan receptor 2
Kinase structure
Kinase:ROR2
Family:Ror
Group:TK
Species:HUMAN
PDB:4GT4
sc-PDB:
KIDFamMap:Search
Release date:2012-09-26
PubMed: 22992069
Chain:B
(Alternate) Model:A
Click to open a 3D viewer
The orthosteric binding pocket


More entries for 4GT4
4GT4Alternative model: AChain: A
4GT4Alternative model: BChain: A
4GT4Alternative model: BChain: B


Structural information
DFG conformation:na
αC-helix conformation:na
G-rich loop angle (distance):65° (18.6Å)
G-rich loop rotation:81.6°
Quality Score:7.6
Resolution:2.41 Å
Missing Residues:0
Missing Atoms:26
Ligand binding mode
Waters
Cluster
I7
I9
Ligand
No
No
Protein
Yes
Yes

Pocket alignment
Uniprot sequence:EELGEDRFGKVYKVAIKTLEFRHEAMLRARLQPNVVCLLGVSMIFSYCSHGDLHEFLVMYLSSHHVVHKDLATRNVLVISDLGLF
Sequence structure:EELGEDRFGKVYKVAIKTLEFRHEAMLRARLQPNVVCLLGVSMIFSYCSHGDLHEFLVMYLSSHHVVHKDLATRNVLVISDLGLF