2XIK - chain A (model B) | Serine/threonine kinase 25
Structure information
PDB: | 2XIK |
PubMed: | - |
Release date: | 2010-07-14 |
Resolution: | 1.97 Å |
Kinase: | STK25 (YSK1) |
Family: | STE20 |
Group: | STE |
Species: | HUMAN |
Quality Score: | 9.2 |
Missing Residues: | 0 |
Missing Atoms: | 8 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (4.2Å) |
ASP rotation (xDFG.81) : | 356° |
PHE rotation (xDFG.82) : | 14° |
Activation loop position: | -3.3Å |
αC-helix position: | 17.9Å |
G-rich loop angle: | 53.6° |
G-rich loop distance: | 15.6Å |
G-rich loop rotation: | 86.8° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I5
H-bond protein
Binding pocket sequence
Uniprot | DRIGKGSFGEVYKVAIKIIDIQQEITVLSQCDPYITRYFGSWIIMEYLGGGSALDLLKPYLHSERKIHRDIKAANVLLLADFGVA |
Structure: | DRIGKGSFGEVYKVAIKIIDIQQEITVLSQCDPYITRYFGSWIIMEYLGGGSALDLLKPYLHSERKIHRDIKAANVLLLADFGVA |
Modified residues
Residue 174 (not in pocket)
Phosphorylated threonine
Orthosteric ligand
Ligand HET-code: J60
Ligand Name: 5-[(E)-(5-CHLORO-2-OXO-1,2-DIHYDRO-3H-INDOL-3-YLIDENE)METHYL]-N-[2-(DIETHYLAMINO)ETHYL]-2,4-DIMETHYL-1H-PYRROLE-3-CARBOXAMIDE
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 D 24 | 2 R 25 | 3 I 26 | 4 G 27 | 5 K 28 | 6 G 29 | 7 S 30 | 8 F 31 | 9 G 32 | 10 E 33 | 11 V 34 | 12 Y 35 | 13 K 36 | 14 V 46 | 15 A 47 | 16 I 48 | 17 K 49 | 18 I 50 | 19 I 51 | 20 D 62 |
■ | ■ | ■ | ■ | ■ | |||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 I 63 | 22 Q 64 | 23 Q 65 | 24 E 66 | 25 I 67 | 26 T 68 | 27 V 69 | 28 L 70 | 29 S 71 | 30 Q 72 | 31 C 73 | 32 D 74 | 33 P 76 | 34 Y 77 | 35 I 78 | 36 T 79 | 37 R 80 | 38 Y 81 | 39 F 82 | 40 G 83 |
■ | |||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 S 84 | 42 W 92 | 43 I 93 | 44 I 94 | 45 M 95 | 46 E 96 | 47 Y 97 | 48 L 98 | 49 G 99 | 50 G 100 | 51 G 101 | 52 S 102 | 53 A 103 | 54 L 104 | 55 D 105 | 56 L 106 | 57 L 107 | 58 K 108 | 59 P 109 | 60 Y 130 |
■ | ▲ | ■ | ■▲ | ■ | ■ | ■ | ■ | ||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 131 | 62 H 132 | 63 S 133 | 64 E 134 | 65 R 135 | 66 K 136 | 67 I 137 | 68 H 138 | 69 R 139 | 70 D 140 | 71 I 141 | 72 K 142 | 73 A 143 | 74 A 144 | 75 N 145 | 76 V 146 | 77 L 147 | 78 L 148 | 79 L 156 | 80 A 157 |
■ | ■ | ||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 158 | 82 F 159 | 83 G 160 | 84 V 161 | 85 A 162 | |||||||||||||||
■ |
Binding affinities
ChEMBL ID:CHEMBL13485Bioaffinities: 12 records for 7 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Epidermal growth factor receptor erbB1 | 5.5 | 5.5 | 5.5 | pIC50 | 1 |
Homo sapiens | Fibroblast growth factor receptor 1 | 6.8 | 6.8 | 6.8 | pIC50 | 2 |
Homo sapiens | Maternal embryonic leucine zipper kinase | 6.1 | 6.1 | 6.1 | pIC50 | 1 |
Homo sapiens | Platelet-derived growth factor receptor beta | 8.5 | 5.5 | 8.5 | pIC50 | 3 |
Homo sapiens | Serine/threonine-protein kinase NEK2 | 5.1 | 5.1 | 5.1 | pIC50 | 1 |
Homo sapiens | Stem cell growth factor receptor | 8 | 8 | 8 | pIC50 | 1 |
Homo sapiens | Vascular endothelial growth factor receptor 2 | 7.6 | 5.5 | 7.6 | pIC50 | 3 |