3O7L - chain D | Protein kinase, cAMP dependent, catalytic, alpha
Structure information
| PDB: | 3O7L |
| PubMed: | 20890288 |
| Release date: | 2010-10-06 |
| Resolution: | 2.8 Å |
| Kinase: | Prkaca (PKACa) |
| Family: | PKA |
| Group: | AGC |
| Species: | MOUSE |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 28 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (3.7Å) |
| ASP rotation (xDFG.81) : | 343° |
| PHE rotation (xDFG.82) : | 11° |
| Activation loop position: | -4.2Å |
| αC-helix position: | 18.1Å |
| G-rich loop angle: | 66.2° |
| G-rich loop distance: | 20.6Å |
| G-rich loop rotation: | 49.4° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I8
No H-bonds
Binding pocket sequence
| Uniprot | KTLGTGSFGRVMLYAMKILHTLNEKRILQAVNPFLVKLEFSYMVMEYVAGGEMFSHLRRYLHSLDLIYRDLKPENLLIVTDFGFA |
| Structure: | KTLGTGSFGRVMLYAMKILHTLNEKRILQAVNPFLVKLEFSYMVMEYVAGGEMFSHLRRYLHSLDLIYRDLKPENLLIVTDFGFA |
Modified residues
Residue 197 (not in pocket)
Phosphorylated threonine
Residue 338 (not in pocket)
Phosphorylated serine