5AR2 - chain B (model B) | Receptor interacting serine/threonine kinase 2
Structure information
PDB: | 5AR2 |
PubMed: | 26455654 |
Release date: | 2015-10-21 |
Resolution: | 2.44 Å |
Kinase: | RIPK2 |
Family: | RIPK |
Group: | TKL |
Species: | HUMAN |
Quality Score: | 8.2 |
Missing Residues: | 3 |
Missing Atoms: | 6 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (3.5Å) |
ASP rotation (xDFG.81) : | 340° |
PHE rotation (xDFG.82) : | 9° |
Activation loop position: | -3.6Å |
αC-helix position: | 17.8Å |
G-rich loop angle: | - |
G-rich loop distance: | - |
G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I5
H-bond protein
Binding pocket sequence
Uniprot | RYLSRGASGTVSSVAVKHLDVLREAEILHKARSYILPILGIGIVTEYMPNGSLNELLHRHNMTPPLLHHDLKTQNILLIADFGLS |
Structure: | RYLSRG___TVSSVAVKHLDVLREAEILHKARSYILPILGIGIVTEYMPNGSLNELLHRHNMTPPLLHHDLKTQNILLIADFGLS |
Modified residues
No modified residues identified.