5AR2 - chain B (model A) | Receptor interacting serine/threonine kinase 2
Structure information
| PDB: | 5AR2 |
| PubMed: | 26455654 |
| Release date: | 2015-10-21 |
| Resolution: | 2.44 Å |
| Kinase: | RIPK2 |
| Family: | RIPK |
| Group: | TKL |
| Species: | HUMAN |
| Quality Score: | 8.2 |
| Missing Residues: | 3 |
| Missing Atoms: | 6 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (3.5Å) |
| ASP rotation (xDFG.81) : | 340° |
| PHE rotation (xDFG.82) : | 9° |
| Activation loop position: | -3.6Å |
| αC-helix position: | 17.8Å |
| G-rich loop angle: | - |
| G-rich loop distance: | - |
| G-rich loop rotation: | - |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I5
H-bond protein
Binding pocket sequence
| Uniprot | RYLSRGASGTVSSVAVKHLDVLREAEILHKARSYILPILGIGIVTEYMPNGSLNELLHRHNMTPPLLHHDLKTQNILLIADFGLS |
| Structure: | RYLSRG___TVSSVAVKHLDVLREAEILHKARSYILPILGIGIVTEYMPNGSLNELLHRHNMTPPLLHHDLKTQNILLIADFGLS |
Modified residues
No modified residues identified.