5NG3 - chain B | Receptor interacting serine/threonine kinase 2
Structure information
PDB: | 5NG3 |
PubMed: | 28545134 |
Release date: | 2017-06-28 |
Resolution: | 2.6 Å |
Kinase: | RIPK2 |
Family: | RIPK |
Group: | TKL |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | out |
Salt bridge KIII.17 and EαC.24: | No (11.1Å) |
ASP rotation (xDFG.81) : | 289° |
PHE rotation (xDFG.82) : | 313° |
Activation loop position: | -5.1Å |
αC-helix position: | 21.4Å |
G-rich loop angle: | 47.9° |
G-rich loop distance: | 14.5Å |
G-rich loop rotation: | 45° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | RYLSRGASGTVSSVAVKHLDVLREAEILHKARSYILPILGIGIVTEYMPNGSLNELLHRHNMTPPLLHHDLKTQNILLIADFGLS |
Structure: | RYLSRGASGTVSSVAVRHLDVLREAEILHKARSYILPILGIGIVTEYMPNGSLNELLHRHNMTPPLLHHDLKTQNILLIADFGLS |
Modified residues
No modified residues identified.