6G18 - chain v | Serine/threonine-protein kinase RIO2
Structure information
PDB: | 6G18 |
PubMed: | 29875412 |
Release date: | 2018-06-06 |
Resolution: | NMR |
Kinase: | RIOK2 |
Family: | RIO |
Group: | Atypical |
Species: | HUMAN |
Quality Score: | 7.6 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (3Å) |
ASP rotation (xDFG.81) : | 336° |
PHE rotation (xDFG.82) : | 7° |
Activation loop position: | -3.2Å |
αC-helix position: | 17.8Å |
G-rich loop angle: | 53.5° |
G-rich loop distance: | 17.6Å |
G-rich loop rotation: | 18.4° |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | NQMGVGKESDIYIFALKLHSAMKEFAYMKALYFPVPKPIDYAVVMELINGYPLCQIHHVLANHG-LIHGDFNEFNLILMIDFPQM |
Structure: | NQMGVGKESDIYIFALKLHSAMKEFAYMKALYFPVPKPIDYAVVMELINGYPLCQIHHVLANHG_LIHGDFNEFNLILMIDFPQM |
Modified residues
No modified residues identified.