3KN5 - chain A | Ribosomal protein S6 kinase A5 (2nd domain)
Structure information
PDB: | 3KN5 |
PubMed: | 20382163 |
Release date: | 2010-04-21 |
Resolution: | 2.4 Å |
Kinase: | RPS6KA5-b (MSK1-b) |
Family: | RSKb |
Group: | CAMK |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.8Å) |
ASP rotation (xDFG.81) : | 335° |
PHE rotation (xDFG.82) : | 0° |
Activation loop position: | -3.7Å |
αC-helix position: | 18.5Å |
G-rich loop angle: | 54.7° |
G-rich loop distance: | 16.7Å |
G-rich loop rotation: | 64° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | KPLGEGSFSICRKFAVKIINTQKEITALKLCEPNIVKLHEVFLVMELLNGGELFERIKKHMHDVGVVHRDLKPENLLFIIDFGFA |
Structure: | KPLGEGSFSICRKFAVKIINTQKEITALKLCEPNIVKLHEVFLVMELLNGGELFERIKKHMHDVGVVHRDLKPENLLFIIDFGFA |
Modified residues
No modified residues identified.
Orthosteric ligand
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 K 430 | 2 P 431 | 3 L 432 | 4 G 433 | 5 E 434 | 6 G 435 | 7 S 436 | 8 F 437 | 9 S 438 | 10 I 439 | 11 C 440 | 12 R 441 | 13 K 442 | 14 F 452 | 15 A 453 | 16 V 454 | 17 K 455 | 18 I 456 | 19 I 457 | 20 N 464 |
■ | ■ | ■ | |||||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 T 465 | 22 Q 466 | 23 K 467 | 24 E 468 | 25 I 469 | 26 T 470 | 27 A 471 | 28 L 472 | 29 K 473 | 30 L 474 | 31 C 475 | 32 E 476 | 33 P 479 | 34 N 480 | 35 I 481 | 36 V 482 | 37 K 483 | 38 L 484 | 39 H 485 | 40 E 486 |
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 V 487 | 42 F 495 | 43 L 496 | 44 V 497 | 45 M 498 | 46 E 499 | 47 L 500 | 48 L 501 | 49 N 502 | 50 G 503 | 51 G 504 | 52 E 505 | 53 L 506 | 54 F 507 | 55 E 508 | 56 R 509 | 57 I 510 | 58 K 511 | 59 K 512 | 60 H 534 |
▲ | ■ | ■▲ | ▲ | ||||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 M 535 | 62 H 536 | 63 D 537 | 64 V 538 | 65 G 539 | 66 V 540 | 67 V 541 | 68 H 542 | 69 R 543 | 70 D 544 | 71 L 545 | 72 K 546 | 73 P 547 | 74 E 548 | 75 N 549 | 76 L 550 | 77 L 551 | 78 F 552 | 79 I 563 | 80 I 564 |
▲ | ■ | ■ | |||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 565 | 82 F 566 | 83 G 567 | 84 F 568 | 85 A 569 | |||||||||||||||
Binding affinities
ChEMBL ID:CHEMBL1230989Bioaffinities: No (p)Ki/(p)IC50/(p)EC50 values for kinases found (with a ChEMBL confidence ≥ 8).