4FNY - chain A | Anaplastic lymphoma receptor tyrosine kinase
Structure information
PDB: | 4FNY |
PubMed: | 22932897 |
Release date: | 2012-08-29 |
Resolution: | 2.45 Å |
Kinase: | ALK |
Family: | ALK |
Group: | TK |
Species: | HUMAN |
Quality Score: | 5.6 |
Missing Residues: | 6 |
Missing Atoms: | 0 |
DFG conformation: | out |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.5Å) |
ASP rotation (xDFG.81) : | 204° |
PHE rotation (xDFG.82) : | 189° |
Activation loop position: | 2.3Å |
αC-helix position: | 18.4Å |
G-rich loop angle: | - |
G-rich loop distance: | - |
G-rich loop rotation: | - |
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | RGLGHGAFGEVYEVAVKTLDFLMEALIISKFNQNIVRCIGVFILLELMAGGDLKSFLREYLEENHFIHRDIAARNCLLIGDFGMA |
Structure: | RGLGHG___EVYEVAVKTLDFLMEALIISKFNQNIVRCIGVFILLELMAGGDLKSFLREYLEENHFIHRDIAARNCLLIGDF___ |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: I3K
Ligand Name: N-(4-chlorophenyl)-5-[(6,7-dimethoxyquinolin-4-yl)oxy]-1,3-benzoxazol-2-amine
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 R 1120 | 2 G 1121 | 3 L 1122 | 4 G 1123 | 5 H 1124 | 6 G 1128 | 7 _ _ | 8 _ _ | 9 _ _ | 10 E 1129 | 11 V 1130 | 12 Y 1131 | 13 E 1132 | 14 V 1147 | 15 A 1148 | 16 V 1149 | 17 K 1150 | 18 T 1151 | 19 L 1152 | 20 D 1163 |
■ | ■ | ■ | ■ | ||||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 F 1164 | 22 L 1165 | 23 M 1166 | 24 E 1167 | 25 A 1168 | 26 L 1169 | 27 I 1170 | 28 I 1171 | 29 S 1172 | 30 K 1173 | 31 F 1174 | 32 N 1175 | 33 Q 1177 | 34 N 1178 | 35 I 1179 | 36 V 1180 | 37 R 1181 | 38 C 1182 | 39 I 1183 | 40 G 1184 |
▲ | ■ | ■ | ■ | ||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 V 1185 | 42 F 1193 | 43 I 1194 | 44 L 1195 | 45 L 1196 | 46 E 1197 | 47 L 1198 | 48 M 1199 | 49 A 1200 | 50 G 1201 | 51 G 1202 | 52 D 1203 | 53 L 1204 | 54 K 1205 | 55 S 1206 | 56 F 1207 | 57 L 1208 | 58 R 1209 | 59 E 1210 | 60 Y 1239 |
■ | ■ | ■ | ■▲ | ■ | ■ | ||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 1240 | 62 E 1241 | 63 E 1242 | 64 N 1243 | 65 H 1244 | 66 F 1245 | 67 I 1246 | 68 H 1247 | 69 R 1248 | 70 D 1249 | 71 I 1250 | 72 A 1251 | 73 A 1252 | 74 R 1253 | 75 N 1254 | 76 C 1255 | 77 L 1256 | 78 L 1257 | 79 I 1268 | 80 G 1269 |
■ | ■ | ■ | ■ | ■ | ■ | ||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 1270 | 82 F 1271 | 83 _ _ | 84 _ _ | 85 _ _ | |||||||||||||||
■▲ | ■♦ |
Binding affinities
ChEMBL ID:CHEMBL3809422Bioaffinities: No (p)Ki/(p)IC50/(p)EC50 values for kinases found (with a ChEMBL confidence ≥ 8).