4IFC - chain A (model A) | Pre-mRNA processing factor 4B
Structure information
PDB: | 4IFC |
PubMed: | 24003220 |
Release date: | 2013-08-28 |
Resolution: | 2.13 Å |
Kinase: | PRPF4B (PRP4) |
Family: | DYRK |
Group: | CMGC |
Species: | HUMAN |
Quality Score: | 9.4 |
Missing Residues: | 0 |
Missing Atoms: | 6 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.8Å) |
ASP rotation (xDFG.81) : | 340° |
PHE rotation (xDFG.82) : | 11° |
Activation loop position: | -3.5Å |
αC-helix position: | 17.4Å |
G-rich loop angle: | 56.8° |
G-rich loop distance: | 17.5Å |
G-rich loop rotation: | 20° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I3
H-bond ligand
H-bond protein
I4
H-bond protein
I5
H-bond ligand
H-bond protein
I7
H-bond ligand
Binding pocket sequence
Uniprot | GYTGQGVFSNVVRVAVKIITGLKELEFLKKLNFHCLRLFRHCLVFEPLS-MNLREVLKKLLKRCNILHADIKPDNILVLCDFGSA |
Structure: | GYTGQGVFSNVVRVAVKIITGLKELEFLKKLNFHCLRLFRHCLVFEPLS_MNLREVLKKLLKRCNILHADIKPDNILVLCDFGSA |
Modified residues
Residue 849 (not in pocket)
Phosphorylated tyrosine
Orthosteric ligand
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 G 691 | 2 Y 692 | 3 T 693 | 4 G 694 | 5 Q 695 | 6 G 696 | 7 V 697 | 8 F 698 | 9 S 699 | 10 N 700 | 11 V 701 | 12 V 702 | 13 R 703 | 14 V 714 | 15 A 715 | 16 V 716 | 17 K 717 | 18 I 718 | 19 I 719 | 20 T 728 |
■ | ▲ | ■ | ■ | ▲● | |||||||||||||||
αC | b.l | IV | |||||||||||||||||
21 G 729 | 22 L 730 | 23 K 731 | 24 E 732 | 25 L 733 | 26 E 734 | 27 F 735 | 28 L 736 | 29 K 737 | 30 K 738 | 31 L 739 | 32 N 740 | 33 F 748 | 34 H 749 | 35 C 750 | 36 L 751 | 37 R 752 | 38 L 753 | 39 F 754 | 40 R 755 |
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 H 756 | 42 C 764 | 43 L 765 | 44 V 766 | 45 F 767 | 46 E 768 | 47 P 769 | 48 L 770 | 49 S 771 | 50 _ _ | 51 M 772 | 52 N 773 | 53 L 774 | 54 R 775 | 55 E 776 | 56 V 777 | 57 L 778 | 58 K 779 | 59 K 780 | 60 L 805 |
▲ | ■▲ | ▲ | |||||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 806 | 62 K 807 | 63 R 808 | 64 C 809 | 65 N 810 | 66 I 811 | 67 L 812 | 68 H 813 | 69 A 814 | 70 D 815 | 71 I 816 | 72 K 817 | 73 P 818 | 74 D 819 | 75 N 820 | 76 I 821 | 77 L 822 | 78 V 823 | 79 L 832 | 80 C 833 |
■ | |||||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 834 | 82 F 835 | 83 G 836 | 84 S 837 | 85 A 838 | |||||||||||||||
Binding affinities
ChEMBL ID:CHEMBL14830Bioaffinities: 2 records for 1 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Mitogen-activated protein kinase kinase kinase 7 | 4.2 | 4.2 | 5.4 | pKd | 2 |