3ZHP - chain C | Serine/threonine kinase 24
Structure information
PDB: | 3ZHP |
PubMed: | 23296203 |
Release date: | 2013-01-16 |
Resolution: | 2.9 Å |
Kinase: | STK24 (MST3) |
Family: | STE20 |
Group: | STE |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 27 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (4.5Å) |
ASP rotation (xDFG.81) : | 354° |
PHE rotation (xDFG.82) : | 351° |
Activation loop position: | -3.8Å |
αC-helix position: | 18Å |
G-rich loop angle: | 68.6° |
G-rich loop distance: | 20Å |
G-rich loop rotation: | 63.8° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
Uniprot | EKIGKGSFGEVFKVAIKIIDIQQEITVLSQCDPYVTKYYGSWIIMEYLGGGSALDLLEPYLHSEKKIHRDIKAANVLLLADFGVA |
Structure: | EKIGKGSFGEVFKVAIKIIDIQQEITVLSQCDPYVTKYYGSWIIMEYLGGGSALDLLEPYLHSEKKIHRDIKAANVLLLADFGVA |
Modified residues
No modified residues identified.