3ZHP - chain C | Serine/threonine kinase 24
Structure information
| PDB: | 3ZHP |
| PubMed: | 23296203 |
| Release date: | 2013-01-16 |
| Resolution: | 2.9 Å |
| Kinase: | STK24 (MST3) |
| Family: | STE20 |
| Group: | STE |
| Species: | HUMAN |
| Quality Score: | 8 |
| Missing Residues: | 0 |
| Missing Atoms: | 27 |
| DFG conformation: | in |
| αC-helix conformation: | in |
| Salt bridge KIII.17 and EαC.24: | Yes (4.5Å) |
| ASP rotation (xDFG.81) : | 354° |
| PHE rotation (xDFG.82) : | 351° |
| Activation loop position: | -3.8Å |
| αC-helix position: | 18Å |
| G-rich loop angle: | 68.6° |
| G-rich loop distance: | 20Å |
| G-rich loop rotation: | 63.8° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
No waters were found in the defined clusters
Binding pocket sequence
| Uniprot | EKIGKGSFGEVFKVAIKIIDIQQEITVLSQCDPYVTKYYGSWIIMEYLGGGSALDLLEPYLHSEKKIHRDIKAANVLLLADFGVA |
| Structure: | EKIGKGSFGEVFKVAIKIIDIQQEITVLSQCDPYVTKYYGSWIIMEYLGGGSALDLLEPYLHSEKKIHRDIKAANVLLLADFGVA |
Modified residues
No modified residues identified.