4H1M - chain A | Protein tyrosine kinase 2 beta
Structure information
PDB: | 4H1M |
PubMed: | 23153798 |
Release date: | 2012-11-28 |
Resolution: | 1.99 Å |
Kinase: | PTK2B (PYK2) |
Family: | FAK |
Group: | TK |
Species: | HUMAN |
Quality Score: | 7.6 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | out |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.6Å) |
ASP rotation (xDFG.81) : | 179° |
PHE rotation (xDFG.82) : | 176° |
Activation loop position: | 2.2Å |
αC-helix position: | 18.5Å |
G-rich loop angle: | 70.9° |
G-rich loop distance: | 20.4Å |
G-rich loop rotation: | 82.1° |
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I4
H-bond ligand
H-bond protein
O2
H-bond ligand
H-bond protein
Binding pocket sequence
Uniprot | RILGEGFFGEVYEVAVKTCKFMSEAVIMKNLDPHIVKLIGIWIIMELYPYGELGHYLERYLESINCVHRDIAVRNILVLGDFGLS |
Structure: | RILGEGFFGEVYEVAVKTCKFMSEAVIMKNLDPHIVKLIGIWIIMELYPYGELGHYLERYLESINCVHRDIAVRNILVLGDFGLS |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: 0YJ
Ligand Name: 7-({[3-tert-butyl-1-(4-methylphenyl)-1H-pyrazol-5-yl]carbamoyl}amino)-N-(propan-2-yl)-1H-indole-2-carboxamide
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 R 429 | 2 I 430 | 3 L 431 | 4 G 432 | 5 E 433 | 6 G 434 | 7 F 435 | 8 F 436 | 9 G 437 | 10 E 438 | 11 V 439 | 12 Y 440 | 13 E 441 | 14 V 454 | 15 A 455 | 16 V 456 | 17 K 457 | 18 T 458 | 19 C 459 | 20 K 470 |
■ | ■ | ■ | ■ | ■ | ■ | ■▲ | |||||||||||||
αC | b.l | IV | |||||||||||||||||
21 F 471 | 22 M 472 | 23 S 473 | 24 E 474 | 25 A 475 | 26 V 476 | 27 I 477 | 28 M 478 | 29 K 479 | 30 N 480 | 31 L 481 | 32 D 482 | 33 P 484 | 34 H 485 | 35 I 486 | 36 V 487 | 37 K 488 | 38 L 489 | 39 I 490 | 40 G 491 |
■▲ | ■ | ■ | ■ | ■ | ■ | ||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 I 492 | 42 W 499 | 43 I 500 | 44 I 501 | 45 M 502 | 46 E 503 | 47 L 504 | 48 Y 505 | 49 P 506 | 50 Y 507 | 51 G 508 | 52 E 509 | 53 L 510 | 54 G 511 | 55 H 512 | 56 Y 513 | 57 L 514 | 58 E 515 | 59 R 516 | 60 Y 539 |
■ | ■ | ||||||||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 540 | 62 E 541 | 63 S 542 | 64 I 543 | 65 N 544 | 66 C 545 | 67 V 546 | 68 H 547 | 69 R 548 | 70 D 549 | 71 I 550 | 72 A 551 | 73 V 552 | 74 R 553 | 75 N 554 | 76 I 555 | 77 L 556 | 78 V 557 | 79 L 565 | 80 G 566 |
■ | ■ | ■ | ■ | ■ | |||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 567 | 82 F 568 | 83 G 569 | 84 L 570 | 85 S 571 | |||||||||||||||
■▲ | ■♦ |
Binding affinities
ChEMBL ID:CHEMBL2207427Bioaffinities: 3 records for 3 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Focal adhesion kinase 1 | 5.1 | 5.1 | 5.1 | pIC50 | 1 |
Homo sapiens | Protein tyrosine kinase 2 beta | 7.1 | 7.1 | 7.1 | pIC50 | 1 |
Mus musculus | Protein-tyrosine kinase 2-beta | 6.3 | 6.3 | 6.3 | pIC50 | 1 |