6FAD - chain C | SRSF protein kinase 1
Structure information
PDB: | 6FAD |
PubMed: | 31641093 |
Release date: | 2019-09-25 |
Resolution: | 2.8 Å |
Kinase: | SRPK1 |
Family: | SRPK |
Group: | CMGC |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | No (5.6Å) |
ASP rotation (xDFG.81) : | 347° |
PHE rotation (xDFG.82) : | 0° |
Activation loop position: | -3.5Å |
αC-helix position: | 19.4Å |
G-rich loop angle: | 65.1° |
G-rich loop distance: | 19.7Å |
G-rich loop rotation: | 43.2° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I4
H-bond protein
Binding pocket sequence
Uniprot | RKLGWGHFSTVWLVAMKVVTALDEIRLLKSVREMVVQLLDDCMVFEVLG-HHLLKWIIKLHTKCRIIHTDIKPENILLIADLGNA |
Structure: | RKLGWGHFSTVWLVAMKVVTALDEIRLLKSVREMVVQLLDDCMVFEVLG_HHLLKWIIKLHTKCRIIHTDIKPENILLIADLGNA |
Modified residues
No modified residues identified.