6QAV - chain C (model A) | Unc-51 like autophagy activating kinase 2
Structure information
PDB: | 6QAV |
PubMed: | 30782972 |
Release date: | 2019-02-27 |
Resolution: | 2.05 Å |
Kinase: | ULK2 |
Family: | ULK |
Group: | Other |
Species: | HUMAN |
Quality Score: | 8 |
Missing Residues: | 0 |
Missing Atoms: | 0 |
DFG conformation: | in |
αC-helix conformation: | in |
Salt bridge KIII.17 and EαC.24: | Yes (2.6Å) |
ASP rotation (xDFG.81) : | 344° |
PHE rotation (xDFG.82) : | 19° |
Activation loop position: | -3.5Å |
αC-helix position: | 17.3Å |
G-rich loop angle: | 51.6° |
G-rich loop distance: | 15.1Å |
G-rich loop rotation: | 57.6° |
Other models from this PDB:
2D & 3D views
Binding pocket waters
The following waters were found in the defined clusters:
I2
H-bond protein
I5
H-bond protein
I11
H-bond ligand
H-bond protein
Binding pocket sequence
Uniprot | DLVGHGAFAVVFRVAIKSILLGKEIKILKELQENIVALYDVFLVMEYCNGGDLADYLQAILHSKGIIHRDLKPQNILLIADFGFA |
Structure: | DLVGHGAFAVVFRVAIKSILLGKEIKILKELQENIVALYDVFLVMEYCNGGDLADYLQAILHSKGIIHRDLKPQNILLIADFGFA |
Modified residues
No modified residues identified.
Orthosteric ligand
Ligand HET-code: HVH
Ligand Name: ~{N}-[3-[[5-cyclopropyl-2-[(2-methyl-3,4-dihydro-1~{H}-isoquinolin-6-yl)amino]pyrimidin-4-yl]amino]propyl]cyclobutanecarboxamide
- Download image
- LABELS
- KLIFS residue #
- Amino Acid
- None
- COLORS
- Interaction types
- KLIFS (all res.)
- KLIFS (interacting res.)
- None
- OTHER
- Show/hide non-interacting res.
- En/disable resizing interacting res.
This ligand targets the following (sub)pockets:
Main pockets | |
---|---|
Front | |
Gate | |
Back |
Subpockets | |
---|---|
FP-I | |
FP-II | |
BP-I-A | |
BP-I-B | |
BP-II-in | |
BP-II-A-in | |
BP-II-B-in | |
BP-II-out | |
BP-II-B | |
BP-III | |
BP-IV | |
BP-V |
Kinase-ligand interactions
■ Hydrophobic ♦ Aromatic face-to-face ♦ Aromatic face-to-edge ▲ H-bond donor ▲ H-bond acceptor ● Ionic positive ● Ionic negative
I | g.l | II | III | αC | |||||||||||||||
1 D 13 | 2 L 14 | 3 V 15 | 4 G 16 | 5 H 17 | 6 G 18 | 7 A 19 | 8 F 20 | 9 A 21 | 10 V 22 | 11 V 23 | 12 F 24 | 13 R 25 | 14 V 36 | 15 A 37 | 16 I 38 | 17 K 39 | 18 S 40 | 19 I 41 | 20 L 52 |
■ | ■ | ■ | ■ | ■ | ■ | ■ | ■ | ||||||||||||
αC | b.l | IV | |||||||||||||||||
21 L 53 | 22 G 54 | 23 K 55 | 24 E 56 | 25 I 57 | 26 K 58 | 27 I 59 | 28 L 60 | 29 K 61 | 30 E 62 | 31 L 63 | 32 Q 64 | 33 E 66 | 34 N 67 | 35 I 68 | 36 V 69 | 37 A 70 | 38 L 71 | 39 Y 72 | 40 D 73 |
■ | |||||||||||||||||||
IV | V | GK | hinge | linker | αD | αE | |||||||||||||
41 V 74 | 42 F 82 | 43 L 83 | 44 V 84 | 45 M 85 | 46 E 86 | 47 Y 87 | 48 C 88 | 49 N 89 | 50 G 90 | 51 G 91 | 52 D 92 | 53 L 93 | 54 A 94 | 55 D 95 | 56 Y 96 | 57 L 97 | 58 Q 98 | 59 A 99 | 60 I 121 |
■ | ■ | ■♦ | ■▲▲ | ■ | ■ | ■▲● | |||||||||||||
αE | VI | c.l | VII | VIII | x | ||||||||||||||
61 L 122 | 62 H 123 | 63 S 124 | 64 K 125 | 65 G 126 | 66 I 127 | 67 I 128 | 68 H 129 | 69 R 130 | 70 D 131 | 71 L 132 | 72 K 133 | 73 P 134 | 74 Q 135 | 75 N 136 | 76 I 137 | 77 L 138 | 78 L 139 | 79 I 156 | 80 A 157 |
■ | ■ | ■ | ■ | ||||||||||||||||
DFG | a.l | ||||||||||||||||||
81 D 158 | 82 F 159 | 83 G 160 | 84 F 161 | 85 A 162 | |||||||||||||||
■ |
Binding affinities
ChEMBL ID:CHEMBL4516990Bioaffinities: 2 records for 2 kinase(s)
Species | Kinase (ChEMBL naming) | Median | Min | Max | Type | Records |
---|---|---|---|---|---|---|
Homo sapiens | Serine/threonine-protein kinase ULK1 | 8.5 | 8.5 | 8.5 | pIC50 | 1 |
Homo sapiens | Serine/threonine-protein kinase ULK2 | 9 | 9 | 9 | pIC50 | 1 |